PA082 Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetG is required for either the stability or assembly of the cytochrome b6-f complex (By similarity). 37 MIEVFLFGIVLGLIPITLAGLFVTAYLQYRRGDQLDL PETG_ORYSA Cytochrome b6-f complex subunit PetG petG Cytochrome b6-f complex subunit V Cytochrome b6-f complex subunit 5 petE